Recombinant Grass carp Glycoprotein hormones alpha chain (CGA) (24-118 aa) [His-tag], HEK 293-F cell (CAT#: GP03-058J)

Product Overview	Recombinant Grass carp Glycoprotein hormones alpha chain (24-118 aa) was expressed in HEK 293-F cell with a His-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	HEK 293-F cell
Species	Grass carp
Fragment	24-118 aa
Sequence	YPRNDMTNFGCEECKLKENNIFSKPGAPVYQC mgCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKEVKRVLVNDVKLVNHTDCHCSTCYYHKS
Tag	His-tag at the N-terminus
Predicted MW	12.7 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	CGA
Full Name	Glycoprotein hormones alpha chain
Uniprot ID	P30983
Background	Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways.
Alternate Names	Anterior pituitary glycoprotein hormones common subunit alpha; Follicle-stimulating hormone alpha chain; FSH-alpha; Follitropin alpha chain