Recombinant Human respiratory syncytial virus A (strain A2) Major surface glycoprotein G (G) (67-298 aa) [10xHis-tag and Myc-tag], Baculovirus

Recombinant Human respiratory syncytial virus A (strain A2) Major surface glycoprotein G (67-298 aa) was expressed in Baculovirus with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.

Determined by its binding ability in a functional ELISA.

Baculovirus

Human respiratory syncytial virus A (strain A2)

67-298 aa

HKVTPTTAIIQDATSQIKNTTPTYLTQNPQLGISPSNPSEITSQITTILASTTPGVKSTLQSTTVKTKNTTTTQTQPSKPTTKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTLKTTKKDPKPQTTKSKEVPTTKPTEEPTINTTKTNIITTLLTSNTTGNPELTSQMETFHSTSSEGNPSPSQVSTTSEYPSQPSSPPNTPRQ

10xHis-tag at the N-terminus and Myc-tag at the C-terminus

29.3 kDa

>90%, determined by SDS-PAGE.

Unconjugated

G

Major surface glycoprotein G

Isoform Membrane-bound glycoprotein G attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection. Isoform Secreted glycoprotein G helps the virus escape antibody-dependent restriction of replication by acting as an antigen decoy and by modulating the activity of leukocytes bearing Fc-gamma receptors.

Major surface glycoprotein G