0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Trypanosoma brucei brucei Envelope glycoprotein (GP) (1-92 aa) [His-tag], E. coli, Biotin labelled (CAT#: GP03-418J)

Datasheet
SizeQtyAdd To Basket
100 μg
500 μg
1 mg

Product Overview Recombinant Trypanosoma brucei brucei Envelope glycoprotein (1-92 aa) was expressed in E. coli with a His-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Trypanosoma brucei brucei
Fragment 1-92 aa
Sequence DQKGKSPESECNKISEEPKCNEDKICSWHKEVKAGEKHCKFNSTKAKEKGVAVTQTQTAGGTEATTDKCKGKLEDTCKKESNCKWEGETCKD
Tag His-tag at the N-terminus
Predicted MW 53.5 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Biotin
Target GP
Full Name Envelope glycoprotein
Uniprot ID P06017
Background Glycoprotein G2 and glycoprotein G1 interact with each other and are present at the surface of the virion. They are able to attach the virion to a cell receptor and to promote fusion of membranes after endocytosis of the virion.
Alternate Names Envelope glycoprotein; Glycoprotein G2; Glycoprotein G1
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving