Recombinant Bovine respiratory syncytial virus (BRSV) (strain A51908) Major surface glycoprotein G (G) (1-263 aa), E. coli

Recombinant Bovine respiratory syncytial virus (BRSV) (strain A51908) Major surface glycoprotein G (1-263 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.

Determined by its binding ability in a functional ELISA.

Bovine respiratory syncytial virus (BRSV) (strain A51908)

1-263 aa

MSNHTHHPKFKTLKRAWKASKYFIVGLSCLYKFNLKSLVQTALTSLAMITLTSLVITAII YISVGNAKAKPTSKPTTQQTQQPQNHTPLLPTEHNHKSTHTSTQSTTLSQPPNIDTTSGT TYGHPINRTQNRKIKSQSTPLATRKLPINPLESNPPENHQDHNNSQTLPHVPCSTCEGNP ACSPLCQIGLERAPSRAPTITLKKAPKPKTTKKPTKTTIYHRTSPEAKLQTKKNTATPQQ GILSSPEHQTNQSTTQISQHTSI

His-tag or Tag free

>90%, determined by SDS-PAGE.

Unconjugated

G

Major surface glycoprotein G

Isoform Membrane-bound glycoprotein G attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection. Isoform Secreted glycoprotein G helps the virus escape antibody-dependent restriction of replication by acting as an antigen decoy and by modulating the activity of leukocytes bearing Fc-gamma receptors.

Major surface glycoprotein G