Recombinant Cercopithecine herpesvirus 9 (CeHV-9) (strain DHV) Envelope glycoprotein I (gI) (21-353 aa), E. coli (CAT#: GPX04-057J)

Product Overview	Recombinant Cercopithecine herpesvirus 9 (CeHV-9) (strain DHV) Envelope glycoprotein I (21-353 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Cercopithecine herpesvirus 9 (CeHV-9) (strain DHV)
Fragment	21-353 aa
Sequence	GIQCAAAIIYRGNYISLYVNSSATSIFLKGNNNDASIRGRFLFIGDQFPVTNTYNVTVEL LHVNQTTLCLQPLYRVMYGECPRIRTGAIIACRVKRSWHYENATQLTDPNVEIIFKMNNT KVEDAGIYLLVVQLDYTSLFDIFFVSLNVYPKQDTSNEDVNYFPPVYSPSHILNTFKICH KFPVHNGMEQSILQHIVTSDVDTETENLSWQKDDLGSTQKPRKNFNPDVKVNVTHETRKT LMESSADVFMIAVPITASLLVILAIIIVVTVGIYRRRSSEKRKIYRPKRTKEQASTEKRE RSESDVLLEAAVARLETIQEENPPHSVINPFTK
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	gI
Full Name	Envelope glycoprotein I
Gene ID	920526
Uniprot ID	Q04547
Background	In epithelial cells, the heterodimer gE/gI is required for the cell-to-cell spread of the virus, by sorting nascent virions to cell junctions. Once the virus reaches the cell junctions, virus particles can spread to adjacent cells extremely rapidly through interactions with cellular receptors that accumulate at these junctions. Implicated in basolateral spread in polarized cells. In neuronal cells, gE/gI is essential for the anterograde spread of the infection throughout the host nervous system.
Alternate Names	Envelope glycoprotein I