Recombinant Equine herpesvirus 1 (EHV-1) (strain AB1) Envelope glycoprotein I (gI) (23-424 aa), E. coli (CAT#: GPX04-085J)

Product Overview	Recombinant Equine herpesvirus 1 (EHV-1) (strain AB1) Envelope glycoprotein I (23-424 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Equine herpesvirus 1 (EHV-1) (strain AB1)
Fragment	23-424 aa
Sequence	IIYRGEHMSMYLNASSEFAVYPTDQSLVLVGHLLFLDGQRLPTTNYSGLIELIHYNYSSV CYTVIQTISYESCPRVANNAFRSCLHKTSKHYHDYFRVNASVETNVLLNITKPQPTDSGA YILRVKLDHAPTADVFGVSAFVYDLKSKTVPDPMPTTQTVEPTTSYVSTPTYDYTDDVTT ETESTSTSTQQAMTSTQTPSATWGTQLTTELPTNETVVIGQEALLCHWFQPSTRVPTLYL HLLGRTGNLPEDVLLVEDSEFLRTTSPAHRPSASPADGDDFKQTNSTSLKARNKIVAMVV IPTACVLMLLLVVVGAIINGAVRKHLLSCASRRIYRSGQGGASAAERRRLTCGPTLAASS ESLADDTTSSPPTPKPSKKTKLETDPLMEQLNRKLEAIKEES
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	gI
Full Name	Envelope glycoprotein I
Gene ID	2948579
Uniprot ID	P68326
Background	In epithelial cells, the heterodimer gE/gI is required for the cell-to-cell spread of the virus, by sorting nascent virions to cell junctions. Once the virus reaches the cell junctions, virus particles can spread to adjacent cells extremely rapidly through interactions with cellular receptors that accumulate at these junctions. Implicated in basolateral spread in polarized cells. In neuronal cells, gE/gI is essential for the anterograde spread of the infection throughout the host nervous system.
Alternate Names	Envelope glycoprotein I