Recombinant Gallid herpesvirus 2 (GaHV-2) (strain Chicken/Md5) Envelope glycoprotein I (gI) (19-355 aa), E. coli (CAT#: GPX04-108J)

Product Overview	Recombinant Gallid herpesvirus 2 (GaHV-2) (strain Chicken/Md5) Envelope glycoprotein I (19-355 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Gallid herpesvirus 2 (GaHV-2) (strain Chicken/Md5)
Fragment	19-355 aa
Sequence	IVYTGTSVTLSTDQSALVAFCGLDKMVNVRGQLLFLGDQTRTSSYTGTTEILKWDEEYKC YSVLHATSYMDCPAIDATVFRGCRDAVVYAQPHDRVQPFPEKGTLLRIVEPRVSDTGSYY IRVALAGRNMSDIFRMAVIIRSSKSWACNHSASSFQAHKCIRYVDRMAFENYLIGHVGNL LDSDSELHAIYNITPQSISTDINIITTPFYDNSGTIYSPTVFNLFNNNSHVDAMNSTGMW NTVLKYTLPRLIYFSTMIVLCIIALAIYLVCERCRSPHRRIYIGEPRSDEAPLITSAVNE SFQYDYNVKETPSDVIEKELMEKLKKKVELLEREECV
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	gI
Full Name	Envelope glycoprotein I
Uniprot ID	Q9E6L5
Background	In epithelial cells, the heterodimer gE/gI is required for the cell-to-cell spread of the virus, by sorting nascent virions to cell junctions. Once the virus reaches the cell junctions, virus particles can spread to adjacent cells extremely rapidly through interactions with cellular receptors that accumulate at these junctions. Implicated in basolateral spread in polarized cells. In neuronal cells, gE/gI is essential for the anterograde spread of the infection throughout the host nervous system.
Alternate Names	Envelope glycoprotein I