Recombinant Human herpesvirus 4 (HHV-4) (strain B95-8) Envelope glycoprotein 150 (BDLF3) (29-234 aa), E. coli (CAT#: GPX04-194J)

Product Overview	Recombinant Human herpesvirus 4 (HHV-4) (strain B95-8) Envelope glycoprotein 150 (29-234 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Human herpesvirus 4 (HHV-4) (strain B95-8)
Fragment	29-234 aa
Sequence	SSTASAGNVTGTTAVTTPSPSASGPSTNQSTTLTTTSAPITTTAILSTNTTTVTFTGTTV TPVPTTSNASTINVTTKVTAQNITATEAGTGTSTGVTSNVTTRSSSTTSATTRITNATTL APTLSSKGTSNATKTTAELPTVPDERQPSLSYGLPLWTLVFVGLTFLMLILIFAAGLMMS AKNKPLDEALLTNAVTRDPSLYKGLV
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	BDLF3
Full Name	Envelope glycoprotein 150
Gene ID	3783694
Uniprot ID	P03224
Background	The Epstein-Barr virus (EBV) open reading frame BDLF3 is predicted to code for a glycoprotein on the basis that it contains sequences with signal peptide and transdomain characteristics and nine potential N-linked glycosylation sites. N
Alternate Names	Glycoprotein BDLF3