Recombinant Rabies virus (RABV) (strain India) Glycoprotein (G) (20-459 aa) [6xHis-tag], Yeast (CAT#: GPX04-365J)

Product Overview	Recombinant Rabies virus (RABV) (strain India) Glycoprotein (20-459 aa) was expressed in Yeast with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	Yeast
Species	Rabies virus (RABV) (strain India)
Fragment	20-459 aa
Sequence	KFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVKTTKESLVIISPSVADLDPYDKSLHSRVFPSGKCSGITISSTYCSTNHDYTIWMPENPRLGTSCDIFTNSRGKRASKGGKTCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMATKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLRVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMELLESSVIPLMHPLADPSTVFKDGDEAEDFVEVHLPDVHKQISGVDLGLPSWGKY
Tag	6xHis-tag at the N-terminus
Predicted MW	51.4 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	G
Full Name	Glycoprotein
Uniprot ID	A3RM22
Background	Attaches the virus to host cellular receptor, inducing endocytosis of the virion. In the endosome, the acidic pH induces conformational changes in the glycoprotein trimer, which trigger fusion between virus and cell membrane.
Alternate Names	Glycoprotein