Recombinant Cupixi mammarenavirus (CPXV)Pre-glycoprotein polyprotein GP complex (GPC) (247-480 aa), E. coli (CAT#: GPX04-069J)

Product Overview	Recombinant Cupixi mammarenavirus (CPXV) (isolate Rat/Brasil/BeAn 119303/1970) Pre-glycoprotein polyprotein GP complex (247-480 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Cupixi mammarenavirus (CPXV) (isolate Rat/Brasil/BeAn 119303/1970)
Fragment	247-480 aa
Sequence	AFFSWSLSDSTGVDMPGGYCLEKWMLIASELKCFGNTALAKCNLKHDSEFCDMIKLFDFN KNAISKLNNNTIEAVNQLTKTVNSLISDNLLMKNRLRELLKVPYCNYTRFWYVNHTRTGE HSLPKCWLVNNGSYLNESDFRNEWILESDHLISEMLSKEYQERQGRTPLTLVDLCFWSAV FYTTTLFLHLVGFPTHRHISGEPCPLPHRLNRHGACNCGRFKRLKKPLVWYKHH
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	GPC
Full Name	Pre-glycoprotein polyprotein GP complex
Gene ID	5848389
Uniprot ID	Q8B115
Background	Glycoprotein G2 is a class I viral fusion protein that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by irreversible conformational changes induced upon acidification in the endosome. Glycoprotein G1 interacts with the host receptor.
Alternate Names	GPC; Pre-GP-C; Stable signal peptide; Glycoprotein G1; Glycoprotein G2