0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Lassa virus (LASV) Pre-glycoprotein polyprotein GP complex (GPC) (59-259 aa) [10xHis-tag and Myc-tag], E. coli (CAT#: GPX04-270J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Lassa virus (LASV) (strain Mouse /Sierra Leone/Josiah/1976) Pre-glycoprotein polyprotein GP complex (NP_694870.1) (59-259 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Lassa virus (LASV) (strain Mouse/Sierra Leone/Josiah/1976)
Fragment 59-259 aa
Sequence TSLYKGVYELQTLELNMETLNMTMPLSCTKNNSHHYIMVGNETGLELTLTNTSIINHKFCNLSDAHKKNLYDHALMSIISTFHLSIPNFNQYEAMSCDFNGGKISVQYNLSHSYAGDAANHCGTVANGVLQTFMRMAWGGSYIALDSGRGNWDCIMTSYQYLIIQNTTWEDHCQFSRPSPIGYLGLLSQRTRDIYISRRLL
Tag 10xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW 27.8 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target GPC
Full Name Pre-glycoprotein polyprotein GP complex
Gene ID 956585
Uniprot ID P08669
Accession Number NP_694870.1
Background Glycoprotein G2 is a class I viral fusion protein that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by irreversible conformational changes induced upon acidification in the endosome. Glycoprotein G1 interacts with the host receptor.
Alternate Names GPC; Pre-GP-C; Stable signal peptide; Glycoprotein G1; Glycoprotein G2
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
  • ()
    ()
    ()
ISO 9001 Certified - Creative Biolabs Quality Management System.
Close
Thanksgiving
Thanksgiving