Recombinant Human Antigen-presenting glycoprotein CD1d (CD1D) (20-301 aa) [6xHis-SUMO-tag], E. coli (CAT#: GPX04-137J)

Product Overview	Recombinant Human Antigen-presenting glycoprotein CD1d (NP_001306074.1) (20-301 aa) was expressed in E. coli with a 6xHis-SUMO-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Human
Fragment	20-301 aa
Sequence	EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYTS
Tag	6xHis-SUMO-tag at the N-terminus
Predicted MW	47.9 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	CD1D
Full Name	Antigen-presenting glycoprotein CD1d
Gene ID	912
Uniprot ID	P15813
Accession Number	NP_001306074.1
Background	Antigen-presenting protein that binds self and non-self glycolipids and presents them to T-cell receptors on natural killer T-cells.
Alternate Names	Antigen-presenting glycoprotein CD1d