Recombinant Tacaribe virus (TCRV) (strain V7) Pre-glycoprotein polyprotein GP complex (GPC) (250-482 aa), E. coli

Recombinant Tacaribe virus (TCRV) (strain V7) Pre-glycoprotein polyprotein GP complex (250-482 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.

Determined by its binding ability in a functional ELISA.

Tacaribe virus (TCRV) (strain V7)

250-482 aa

AFFSWSLTDPLGNEAPGGYCLEKWMLVASELKCFGTLQCQVQPKSRLRVCDMLRLFDYNK NAIKTLNEETKTRVNVLSHTINALISDNLLMKNKIRELMSVPYCNYTRFWYVNHTLSGQH SLPRCWMIRNNSYLNSSEFRNEWILESDFLISEMLSKEYSERQGRTPITLVDICFWSTEF FISTLFLHLIGFPTHEHIRGEGCPLPHRLNSMGGCRCGKYLPLKKPTIWHRRH

His-tag or Tag free

>90%, determined by SDS-PAGE.

Unconjugated

GPC

Pre-glycoprotein polyprotein GP complex

Glycoprotein G2 is a class I viral fusion protein that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by irreversible conformational changes induced upon acidification in the endosome. Glycoprotein G1 interacts with the host receptor.

GPC; Pre-GP-C; Stable signal peptide; Glycoprotein G1; Glycoprotein G2