0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Tacaribe virus (TCRV) (strain V7) Pre-glycoprotein polyprotein GP complex (GPC) (250-482 aa), E. coli (CAT#: GPX04-428J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Tacaribe virus (TCRV) (strain V7) Pre-glycoprotein polyprotein GP complex (250-482 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Tacaribe virus (TCRV) (strain V7)
Fragment 250-482 aa
Sequence AFFSWSLTDPLGNEAPGGYCLEKWMLVASELKCFGTLQCQVQPKSRLRVCDMLRLFDYNK NAIKTLNEETKTRVNVLSHTINALISDNLLMKNKIRELMSVPYCNYTRFWYVNHTLSGQH SLPRCWMIRNNSYLNSSEFRNEWILESDFLISEMLSKEYSERQGRTPITLVDICFWSTEF FISTLFLHLIGFPTHEHIRGEGCPLPHRLNSMGGCRCGKYLPLKKPTIWHRRH
Tag His-tag or Tag free
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target GPC
Full Name Pre-glycoprotein polyprotein GP complex
Uniprot ID P31842
Background Glycoprotein G2 is a class I viral fusion protein that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by irreversible conformational changes induced upon acidification in the endosome. Glycoprotein G1 interacts with the host receptor.
Alternate Names GPC; Pre-GP-C; Stable signal peptide; Glycoprotein G1; Glycoprotein G2
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
  • ()
    ()
    ()
ISO 9001 Certified - Creative Biolabs Quality Management System.
Close
Thanksgiving
Thanksgiving