Recombinant Alcelaphine herpesvirus 1 (AlHV-1) Envelope glycoprotein N (gN) (26-103 aa), E. coli (CAT#: GPX04-002J)

Product Overview	Recombinant Alcelaphine herpesvirus 1 (AlHV-1) Envelope glycoprotein N (NP_065552.1) (26-103 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Alcelaphine herpesvirus 1 (AlHV-1)
Fragment	26-103 aa
Sequence	SSTPRAVTHPVLNATSNFNPTAGFYSFSCNADTYLLRLNSFSSIWALMNVFVVLVSTVVF MTYLCFTKFVHTLIYQQK
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	gN
Full Name	Envelope glycoprotein N
Gene ID	911770
Uniprot ID	O36403
Accession Number	NP_065552.1
Background	Envelope glycoprotein necessary for proper maturation of gM and modulation of its membrane fusion activity. Plays also a critical role in virion morphogenesis.
Alternate Names	Envelope glycoprotein N