BMAP-28, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ143)
Product Quick View
BMAP-28 is an antibiotic peptide and an inducer of the mitochondrial permeability transition pore. BMAP-28 induces cell death through opening of the mitochondrial permeability transition pore. BMAP-28 can be used in study of microbial infections and cancer.
| Overview | |
|---|---|
| Synonyms | BMAP-28; Bovine myeloid antimicrobial peptide 28; Bac5 related |
| Source | Bovine |
| Sequence | Gly-Gly-Leu-Arg-Ser-Leu-Gly-Arg-Lys-Ile-Leu-Arg-Ala-Trp-Lys-Lys-Tyr-Gly-Pro-Ile-Ile-V al-Pro-Ile-Ile-Arg-Ile-NH2 |
| Sequence Shortening | GGLRSLGRKILRAWKKYGPIIVPIIRI-NH2 |
| Activity | Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; HIV; Cancer; Biofilm; LPS; Immunomodulation; Bovine; Cathelicidin |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
Related products
- Ubiquicidin (29-41), Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ45)
- Bombolitin II, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ306)
- Maximin H4, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ520)
- SGNLTKYWKKIWKPGIKKWIK, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ84)
- Jelleine-II, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ452)
- P1 peptide, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ543)
- OV-1 (sheep), Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ542)
- Crabrolin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ355)
Online Inquiry