Cecropin A TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ39)
Product Quick View
Cecropin A TFA is a linear 37-residue antimicrobial polypeptide isolated from Hyalaphora cecropia pupae. Cecropin A TFA exhibits anti-bacterial, anti-inflammatory and anti-cancer activity.
| Overview | |
|---|---|
| Synonyms | Cecropin A TFA; Cecropin A; Cecropin-A |
| Source | Insect |
| Molecular Formula | C186H314N53O48 |
| Molecular Weight | 4117.8 |
| Sequence | Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Al a-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2 |
| Sequence Shortening | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2 |
| Activity | Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; Cancer; Anti-inflammatory; Insect |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
Related products
- Pediocin PA-1 TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ145)
- Bombolitin III, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ307)
- XT-2 peptide, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ647)
- CRAMP-18 (mouse), Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ359)
- Human α-defensin 1 TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ53)
- Omiganan (FITC labeled) TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ538)
- A-54556A, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ244)
- L-K6L9, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ470)
Online Inquiry