Home
Products
Antimicrobial Peptides
Cm-CATH2, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ346)

Cm-CATH2, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ346)

Name: Cm-CATH2, Antimicrobial Peptide (AMP)
SKU: BMWJ-0826-WJ346
Rating: 5 (1 reviews)

Product Quick View

Cm-CATH2 is an antimicrobial peptide discovered from Chelonia mydas. Cm-CATH2 has a potent, broad-spectrum and rapid bactericidal ability by rapidly destroying the integrity of bacterial cell membranes. It shows strong activity against Gram-positive bacteria (such as VREF, Staphylococcus aureus), Gram-negative bacteria (such as Escherichia coli, Klebsiella pneumoniae), and fungi (such as Candida albicans) with MICs ranges from 1.17 to 18.75 μg/mL. Cm-CATH2 is also effective against various aquatic pathogenic bacteria. Cm-CATH2 not only inhibits biofilm formation but can also remove the formed biofilms. Cm-CATH2 has immunomodulatory functions and chemotactic effects on immune cells, and can inhibit the production of pro-inflammatory cytokines by macrophages stimulated by LPS (HY-D1056). Cm-CATH2 prevents the activation of NF-κB by inhibiting the degradation of IκBα, and also inhibits the phosphorylation of MAPK signaling pathways (p38, JNK, ERK). Cm-CATH2 demonstrates strong anti-infective ability in mouse peritonitis models and pneumonia models.

Overview
Synonyms	Cm-CATH2; Chameleon cathelicidin 2
Source	Snake/Reptile
Sequence	Arg-Arg-Ser-Arg-Phe-Gly-Arg-Phe-Phe-Lys-Lys-Val-Arg-Lys-Gln-Leu-Gly-Arg-Val-Leu-Ar g-His-Ser-Arg-Ile-Thr-Val-Gly-Gly-Arg-Met-Arg-Phe
Sequence Shortening	RRSRFGRFFKKVRKQLGRVLRHSRITVGGRMRF
Activity	Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; HIV; Cancer; Biofilm; LPS; Snake; Calloselasma rhodostoma
Physical State	Powder
Purity	>98%
Storage	The power can be stored at 4°C for 2 years or at -20°C for 3 years.

For Research Use Only.