Cm-CATH2, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ346)
Cm-CATH2 is an antimicrobial peptide discovered from Chelonia mydas. Cm-CATH2 has a potent, broad-spectrum and rapid bactericidal ability by rapidly destroying the integrity of bacterial cell membranes. It shows strong activity against Gram-positive bacteria (such as VREF, Staphylococcus aureus), Gram-negative bacteria (such as Escherichia coli, Klebsiella pneumoniae), and fungi (such as Candida albicans) with MICs ranges from 1.17 to 18.75 μg/mL. Cm-CATH2 is also effective against various aquatic pathogenic bacteria. Cm-CATH2 not only inhibits biofilm formation but can also remove the formed biofilms. Cm-CATH2 has immunomodulatory functions and chemotactic effects on immune cells, and can inhibit the production of pro-inflammatory cytokines by macrophages stimulated by LPS (HY-D1056). Cm-CATH2 prevents the activation of NF-κB by inhibiting the degradation of IκBα, and also inhibits the phosphorylation of MAPK signaling pathways (p38, JNK, ERK). Cm-CATH2 demonstrates strong anti-infective ability in mouse peritonitis models and pneumonia models.
| Overview | |
|---|---|
| Synonyms | Cm-CATH2; Chameleon cathelicidin 2 |
| Source | Snake/Reptile |
| Sequence | Arg-Arg-Ser-Arg-Phe-Gly-Arg-Phe-Phe-Lys-Lys-Val-Arg-Lys-Gln-Leu-Gly-Arg-Val-Leu-Ar g-His-Ser-Arg-Ile-Thr-Val-Gly-Gly-Arg-Met-Arg-Phe |
| Sequence Shortening | RRSRFGRFFKKVRKQLGRVLRHSRITVGGRMRF |
| Activity | Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; HIV; Cancer; Biofilm; LPS; Snake; Calloselasma rhodostoma |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
- GLR-19, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ417)
- LCI peptide, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ220)
- LL-37 FKR, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ475)
- Omiganan pentahydrochloride, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ68)
- KK14(R), Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ455)
- Aurein 5.2, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ277)
- Bombinin H5, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ297)
- Bombinin-like peptide 2, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ302)
