CRAMP, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ59)
Product Quick View
CRAMP (mouse) is an antibacterial peptide and a functional homolog of LL-37. CRAMP (mouse) exhibits potent antibacterial activity against Gram-negative bacteria. The complex formed by CRAMP (mouse) and CpG can activate macrophages to secrete TNF-α. CRAMP (mouse) plays a key role in wound healing, immune regulation and maintenance of intestinal homeostasis.
| Overview | |
|---|---|
| Synonyms | CRAMP (mouse); CRAMP; Cathelin-related antimicrobial peptide; Mouse cathelicidin; mCRAMP |
| Source | Mouse |
| CAS | 376364-36-2 |
| Molecular Formula | C178H302N50O46 |
| Molecular Weight | 3878.61 |
| Sequence | Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-L ys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln |
| Sequence Shortening | GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ |
| Activity | Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; HIV; Cancer; Biofilm; LPS; Immunomodulation; Mouse; Cathelicidin |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
Related products
- LANA peptide, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ460)
- Alytesin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ256)
- Maximin 49, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ507)
- KAMP-19, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ454)
- Drosocin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ391)
- IDR-1018 acetate, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ80)
- Polymyxin B Sulfate, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ34)
- Garvicin KS (GakC), Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ414)
Online Inquiry
