Cys-LL-37, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ365)
Product Quick View
Cys-LL37 is a biomaterial with antimicrobial properties developed by covalently fixing to the surface of titanium. Cys-LL37 uses a flexible hydrophilic polyethylene glycol spacer and selective n-terminal coupling LL37, a surface peptide layer that kills bacteria on contact is formed. Cys-LL37 can be used in research to develop new antimicrobial biomaterials.
| Overview | |
|---|---|
| Synonyms | Cys-LL37; Cys-LL-37; Cysteine-modified LL-37 |
| Source | Human |
| Sequence | Cys-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Il e-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser |
| Sequence Shortening | CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Activity | Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; HIV; Cancer; Biofilm; LPS; Immunomodulation; Human; Cathelicidin |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
Related products
- Lauryl-LF11 TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ463)
- G(IIKK)3I-NH2, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ407)
- Lactocin 705α, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ458)
- SMR efflux inhibitor peptide, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ603)
- Lactoferricin B, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ149)
- LL-37-Cys, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ657)
- DD-S067, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ369)
- Bombolitin I, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ305)
Online Inquiry