DN59, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ389)
Product Quick View
DN59 is a 33 amino acid peptide that mimics the dengue virus type 2 E stem region. DN59 inhibits all four serotypes of dengue virus (IC50: 2-5 μM) as well as other flaviviruses. N59 causes the release of genomic RNA by interacting directly with viral particles. DN59 has antiviral activity.
| Overview | |
|---|---|
| Synonyms | DN59; DN-59; Dengue virus entry inhibitor peptide |
| Source | Synthetic |
| Sequence | Met-Ala-Ile-Leu-Gly-Asp-Thr-Ala-Trp-Asp-Phe-Gly-Ser-Leu-Gly-Gly-Val-Phe-Thr-Ser-Ile -Gly-Lys-Ala-Leu-His-Gln-Val-Phe-Gly-Ala-Ile-Tyr |
| Sequence Shortening | MAILGDTAWDFGSLGGVFTSIGKALHQVFGAIY |
| Activity | Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; Cancer cells; Biofilm |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
Related products
- Peceleganan acetate, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ172)
- XT-2 peptide, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ647)
- Bactenecin TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ70)
- 3-WP, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ651)
- Caerin 1.1 TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ215)
- Retro-indolicidin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ588)
- Brevinin-1PMa, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ316)
- LL-37 (17-32), Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ162)
Online Inquiry