Enterocin K1, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ142)
Product Quick View
Enterocin K1 (EntK1) is a bacteriocin. Enterocin K1 is a ribosomal synthetic peptide. Enterocin K1 specifically targets Enterococcus faecalis via the Eep protein on the bacterial membrane. Enterocin K1 displays a potent antibacterial activity against VRE. Enterocin K1 can be used for related studies of VRE infections.
| Overview | |
|---|---|
| Synonyms | EntK1; Enterocin K1; Enterocin |
| Source | Bacteria |
| CAS | 2764845-22-7 |
| Molecular Formula | C218H321N53O51S2 |
| Molecular Weight | 4564.34 |
| Sequence | Met-Lys-Phe-Lys-Phe-Asn-Pro-Thr-Gly-Thr-Ile-Val-Lys-Lys-Leu-Thr-Gln-Tyr-Glu-Ile-Ala -Trp-Phe-Lys-Asn-Lys-His-Gly-Tyr-Tyr-Pro-Trp-Glu-Ile-Pro-Arg-Cys |
| Sequence Shortening | MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC |
| Activity | Gram-positive bacteria; Cell membrane; Listeria; Bacteriocin |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
Related products
- PP113, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ576)
- C18G, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ325)
- Combi-1, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ350)
- OP-145, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ541)
- Maximin 32, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ501)
- DFTamP1, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ384)
- IDR-1018, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ81)
- Dermaseptin-B4, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ375)
Online Inquiry