LEAP-2, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ3)
Product Quick View
LEAP-2 (Human liver expressed antimicrobial peptide-2) is a GHS-R1a antagonist, with an IC50 of 6.0 nM. LEAP-2 suppresses the orexigenic effect of ghrelin. LEAP-2 attenuates ghrelin-induced growth hormone (GH) release and reduces basal food intake. LEAP-2 exhibits antimicrobial activity against microbial model organisms. LEAP-2 can be used for the study of obesity and infection.
| Overview | |
|---|---|
| Synonyms | Human liver expressed antimicrobial peptide-2; LEAP-2; Liver-expressed antimicrobial peptide 2 |
| Source | Human |
| CAS | 1683582-94-6 |
| Molecular Formula | C191H316N64O57S5 |
| Molecular Weight | 4581.27 |
| Sequence | Met-Thr-Pro-Phe-Trp-Arg-Gly-Val-Ser-Leu-Arg-Pro-Ile-Gly-Ala-Ser-Cys-Arg-Asp-Asp-Se r-Glu-Cys-Ile-Thr-Arg-Leu-Cys-Arg-Lys-Arg-Arg-Cys-Ser-Leu-Ser-Val-Ala-Gln-Glu (Disulf ide bridge:Cys17-Cys28;Cys23-Cys33) |
| Sequence Shortening | MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE (Disulfide bridge:Cys17-Cys28;C ys23-Cys33) |
| Activity | Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; Cancer; GHSR; Iron; Human; Liver-expressed |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
Related products
- Polistes mastoparan, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ213)
- ChMAP-28, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ337)
- d-WRL, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ654)
- C5A, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ326)
- FGF basic (1-24), Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ60)
- Temporin A, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ115)
- Plantaricin A, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ121)
- PMAP-36, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ231)
Online Inquiry
