LL-37 acetate, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ13)
Product Quick View
LL-37, human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human acetate could help protect the cornea from infection and modulates wound healing.
| Overview | |
|---|---|
| Synonyms | LL-37, human acetate; LL-37; LL-37 peptide; Cathelicidin; hCAP18; Human cationic antimicrobial protein 18; CAMP; Cathelicidin antimicrobial peptide |
| Source | Human |
| CAS | 154947-66-7 |
| Molecular Formula | C205H340N60O53 |
| Molecular Weight | 4493.26 (free base) |
| Sequence | Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val -Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser |
| Sequence Shortening | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Activity | Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; HIV; Cancer; Biofilm; LPS; Immunomodulation; Human; Cathelicidin |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
Related products
- HPA3NT3-A2, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ438)
- Pelteobagrin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ554)
- Bombinin-like peptide 3, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ303)
- Dermaseptin-S1, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ212)
- Coccinin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ349)
- Histatin 8, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ127)
- HYNIC-UBI (29-41), Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ229)
- Cecropin P1 acetate, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ73)
Online Inquiry
