Pardaxin P4, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ552)
Product Quick View
Pardaxin P 4 is an antimicrobial peptide found in the secretions of Red Sea Moses sole. Pardaxin P 4 acts as a biomembrane perforator that can interact with phospholipid bilayers of different compositions and induce cytotoxicity and pore formation. Pardaxin P 4 can be used in the research of antimicrobial drugs.
| Overview | |
|---|---|
| Synonyms | Pardaxin P 4; Pardaxin P4; Pardaxin-4 |
| Source | Not specified |
| Sequence | Gly-Phe-Phe-Ala-Leu-Ile-Pro-Lys-Ile-Ile-Ser-Ser-Pro-Leu-Phe-Lys-Thr-Leu-Leu-Ser-Ala -Val-Gly-Ser-Ala-Leu-Ser-Ser-Ser-Gly-Gly-Gln-Glu |
| Sequence Shortening | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE |
| Activity | Gram-positive bacteria; Gram-negative bacteria; Fungi; ROS; LPS; Inflammation |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
Related products
- Baceridin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ128)
- Brevicidine analog 22, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ312)
- Maximin 8, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ514)
- Im5, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ448)
- Parasin I TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ205)
- Pentalysine, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ555)
- Daptomycin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ23)
- Citrullinated LL-37 (5cit), Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ345)
Online Inquiry