Phenol-soluble modulin β, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ210)
Product Quick View
PSM-β is a active peptide , which can be isolated from Staphylococcus epidermidis. PSM-β is an analog of staphylococcal toxins, as well as a termed phenol-soluble modulin. PSM-β has bacteriostatic and poorly hemolytic properties.
| Overview | |
|---|---|
| Synonyms | PSM-β; PSM beta; Phenol-soluble modulin beta |
| Source | Synthetic/Derived |
| Molecular Weight | 4639.28 |
| Sequence | Met-Ser-Lys-Leu-Ala-Glu-Ala-Ile-Ala-Asn-Thr-Val-Lys-Ala-Ala-Gln-Asp-Gln-Asp-Trp-Thr -Lys-Leu-Gly-Thr-Ser-Ile-Val-Asp-Ile-Val-Glu-Ser-Gly-Val-Ser-Val-Leu-Gly-Lys-Ile-Phe-G ly-Phe |
| Sequence Shortening | MSKLAEAIANTVKAAQDQDWTKLGTSIVDIVESGVSVLGKIFGF |
| Activity | Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; Cancer cells; Biofilm; Immunomodulation |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
Related products
- Pilosulin-1(86-112), Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ569)
- Brevinin-2EC, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ318)
- Delta-hemolysin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ204)
- SAAP-148 TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ57)
- BMAP-27, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ174)
- Lunasin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ46)
- Quinupristin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ36)
- SAIRGA TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ598)
Online Inquiry