RL-37, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ591)
Product Quick View
RL-37 is an alpha-helical antimicrobial peptide. RL-37 can be isolated for rhesus monkey bone marrow. RL-37 rapidly permeabilizes the membranes of Escherichia coli ML-35p and lysed liposomes. RL-37 has effective antibacterial activity against staphylococci, such as wild-type and Methicillin (HY-121544)-resistant S. aureus strains and S. epidermidis. RL-37 can be used for human skin infections research.
| Overview | |
|---|---|
| Synonyms | RL-37; RL37; LL-37 related peptide |
| Source | Synthetic/Derived |
| Sequence | Arg-Leu-Gly-Asn-Phe-Phe-Arg-Lys-Val-Lys-Glu-Lys-Ile-Gly-Gly-Gly-Leu-Lys-Lys-Val-Gly -Gln-Lys-Ile-Lys-Asp-Phe-Leu-Gly-Asn-Leu-Val-Pro-Arg-Thr-Ala-Ser |
| Sequence Shortening | RLGNFFRKVKEKIGGGLKKVGQKIKDFLGNLVPRTAS |
| Activity | Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; HIV; Cancer cells; Biofilm; LPS; Immunomodulation |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
Related products
- Histatin 5 TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ77)
- LY121019, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ485)
- SAAP-148, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ58)
- Maximin 45, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ506)
- Murepavadin TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ17)
- Maximin H7, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ522)
- d-KLA Peptide, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ96)
- CyLip-20, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ177)
Online Inquiry