5-FAM-LL-37 TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ217)
Product Quick View
5-FAM-LL-37 TFA is the TFA salt form of 5-FAM-LL-37 (HY-P5057). 5-FAM-LL-37 TFA is a LL-37 peptide labeled with fluorescein, which retains the antibacterial and immunomodulatory activities of LL-37. 5-FAM-LL-37 TFA binds to the bacterial cell membrane, destroys the integrity of the membrane, and exhibits board-spectrum antibacterial efficacy.
| Overview | |
|---|---|
| Synonyms | 5-FAM-LL-37 TFA; 5-FAM-LL-37; FAM-labeled LL-37; Fluorescein-LL-37 |
| Source | Synthetic/Derived |
| Molecular Weight | 4851.56 (free acid) |
| Sequence | {Fluorescein-5-carbonyl}-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-L ys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr- Glu-Ser |
| Sequence Shortening | {Fluorescein-5-carbonyl}[LL-37, 37 aa] |
| Activity | Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; Cancer cells; Biofilm; Fluorescent probe |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
Related products
- LAH4, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ119)
- Aurein 2.2, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ269)
- HVF18-a3-d, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ445)
- Iturin A, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ33)
- Iseganan, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ163)
- SAIRGA TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ598)
- Dermaseptin-B5, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ376)
- Larazotide, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ25)
Online Inquiry