Cecropin A, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ10)
Product Quick View
Cecropin A is a linear 37-residue antimicrobial polypeptide, with anticancer and anti-inflammatory activity.
| Overview | |
|---|---|
| Synonyms | Cecropin A; Cecropin-A |
| Source | Insect |
| CAS | 80451-04-3 |
| Molecular Formula | C184H313N53O46 |
| Molecular Weight | 4003.78 |
| Sequence | Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Al a-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2 |
| Sequence Shortening | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2 |
| Activity | Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; Cancer; Anti-inflammatory; Insect |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
Related products
- ALA-A2 peptide, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ253)
- Pantinin-2, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ549)
- LF11 TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ87)
- Cecropin D, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ333)
- c(R3W4V), Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ320)
- CyPep-1, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ158)
- L-K6L9, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ470)
- PGLa TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ48)
Online Inquiry