Cecropin D, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ333)
Product Quick View
Cecropin D is an antimicrobial peptide with a MIC of 4.55 μg/mL. Cecropin D is effective against both Gram-negative and Gram-positive bacteria. Cecropin D has antiviral, antifungal, antitumor, and immunomodulatory.
| Overview | |
|---|---|
| Synonyms | Cecropin D; Cecropin-D |
| Source | Insect |
| Sequence | Trp-Asn-Pro-Phe-Lys-Glu-Leu-Glu-Lys-Val-Gly-Gln-Arg-Val-Arg-Asp-Ala-Val-Ile-Ser-Ala- Gly-Pro-Ala-Val-Ala-Thr-Val-Ala-Gln-Ala-Thr-Ala-Leu-Ala-Lys-Asn-His-NH2 |
| Sequence Shortening | WNPFKELEKVGQRVRDAVISAGPAVATVAQATALAK-NH2 |
| Activity | Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; Cancer; Anti-inflammatory; Insect |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
Related products
- CysHHC10, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ364)
- Maximin 5, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ508)
- Periplanetasin-2, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ563)
- IDR-1018, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ81)
- Temporin B, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ617)
- Anoplin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ260)
- Melittin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ9)
- Hispidalin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ436)
Online Inquiry