EK1, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ394)
Product Quick View
EK1 is a peptide-based fusion inhibitor of coronaviruses (CoVs) with broad spectrum inhibition to a number of CoV species. EK1 shows substantially improved pan-CoV fusion inhibitory activity. EK1 potently inhibits SARS-CoV-2. EK1 can form a stable six-helix bundle (6HB) structure with both short α-hCoV and long β-hCoV N-terminal heptad repeats.
| Overview | |
|---|---|
| Synonyms | EK1; EK1 peptide |
| Source | Synthetic |
| Sequence | Ser-Leu-Asp-Gln-Ile-Asn-Val-Thr-Phe-Leu-Asp-Leu-Glu-Tyr-Glu-Met-Lys-Lys-Leu-Glu-G lu-Ala-Ile-Lys-Lys-Leu-Glu-Glu-Ser-Tyr-Ile-Asp-Leu-Lys-Glu-Leu |
| Sequence Shortening | SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL |
| Activity | Virus; Coronavirus; Fusion inhibitor; Antiviral |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
Related products
- Maximin H39, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ519)
- Cyclo(Arg-Pro), Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ200)
- OV-1 (sheep), Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ542)
- GLK-19, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ415)
- Pilosulin-1(86-112), Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ569)
- LL-37 (17-32), Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ162)
- Citrocin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ340)
- Peptide HV2, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ560)
Online Inquiry