Human β-defensin 1, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ203)
Product Quick View
Human β-defensin-1 (HβD-1) is a cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by all epithelial surfaces, but also by circulatory cells and cells of the reproductive tract. Human β-defensin-1 has antimicrobial activities against a broad-sperm bacteria.
| Overview | |
|---|---|
| Synonyms | HβD-1; Human β-defensin-1; hBD-1; DEFB1; Beta-defensin 1 |
| Source | Human |
| CAS | 452274-53-2 |
| Molecular Formula | C167H256N48O50S6 |
| Molecular Weight | 3928.53 |
| Sequence | Asp-His-Tyr-Asn-Cys-Val-Ser-Ser-Gly-Gly-Gln-Cys-Leu-Tyr-Ser-Ala-Cys-Pro-Ile-Phe-Thr -Lys-Ile-Gln-Gly-Thr-Cys-Tyr-Arg-Gly-Lys-Ala-Lys-Cys-Cys-Lys (Disulfide bridge:Cys5-C ys34; Cys12-Cys27; Cys17-Cys35) |
| Sequence Shortening | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge:Cys5-Cys34; Cys12- Cys27; Cys17-Cys35) |
| Activity | Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; Cancer; Human |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
Related products
- Mram 8, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ531)
- Retro-indolicidin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ588)
- Lynronne-1, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ486)
- PP102, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ575)
- Pyrrhocoricin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ580)
- Pediocin PA-1 TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ145)
- Drosocin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ391)
- Brevinin-1E, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ314)
Online Inquiry