LL-37 scrambled peptide acetate, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ198)
Product Quick View
LL-37 scrambled peptide acetate is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide acetate can be used as a negative control of LL-37 peptide studies.
| Overview | |
|---|---|
| Synonyms | LL-37 scrambled peptide acetate; LL-37 scrambled peptide; sLL-37; Scrambled LL-37; LL-37 negative control |
| Source | Synthetic |
| Molecular Weight | 4493.30 (free acid) |
| Sequence | Gly-Leu-Lys-Leu-Arg-Phe-Glu-Phe-Ser-Lys-Ile-Lys-Gly-Glu-Phe-Leu-Lys-Thr-Pro-Glu-V al-Arg-Phe-Arg-Asp-Ile-Lys-Leu-Lys-Asp-Asn-Arg-Ile-Ser-Val-Gln-Arg |
| Sequence Shortening | GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR |
| Activity | Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; Cancer cells; Biofilm; Negative control |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
Related products
- LDKA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ466)
- Combi-2, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ351)
- EK1, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ394)
- [(Cys(Bzl)84,Glu(OBzl)85)]CD4 (81-92), Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ240)
- SAAP-148 TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ57)
- SPR741 TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ38)
- Xenopsin precursor fragment, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ644)
- Caerin 1.1 TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ215)
Online Inquiry
