Pardaxin P5 TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ214)
Product Quick View
Pardaxin P5 TFA is the TFA salt form of Pardaxin P5 (HY-P5803). Pardaxin P5 TFA is an antimicrobial peptide that inhibits Escherichia coli with a MIC value of 13 μM.
| Overview | |
|---|---|
| Synonyms | Pardaxin P5 TFA; Pardaxin P5; Pardaxin-5; Pardaxin |
| Source | Not specified |
| Sequence | Gly-Phe-Phe-Ala-Leu-Ile-Pro-Lys-Ile-Ile-Ser-Ser-Pro-Leu-Phe-Lys-Thr-Leu-Leu-Ser-Ala -Val-Gly-Ser-Ala-Leu-Ser-Ser-Ser-Gly-Asp-Gln-Glu |
| Sequence Shortening | GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE |
| Activity | Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; Cancer cells; Biofilm; Immunomodulation |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
Related products
- Distinctin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ387)
- Bactofencin A, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ284)
- Cys-LL-37, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ365)
- Cyclo(Arg-Pro), Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ200)
- Maximin 41, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ504)
- CAP 37 (20-44), Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ328)
- PMAP-36, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ231)
- P1 peptide, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ543)
Online Inquiry