Pardaxin P5 TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ214)
Product Quick View
Pardaxin P5 TFA is the TFA salt form of Pardaxin P5 (HY-P5803). Pardaxin P5 TFA is an antimicrobial peptide that inhibits Escherichia coli with a MIC value of 13 μM.
| Overview | |
|---|---|
| Synonyms | Pardaxin P5 TFA; Pardaxin P5; Pardaxin-5; Pardaxin |
| Source | Not specified |
| Sequence | Gly-Phe-Phe-Ala-Leu-Ile-Pro-Lys-Ile-Ile-Ser-Ser-Pro-Leu-Phe-Lys-Thr-Leu-Leu-Ser-Ala -Val-Gly-Ser-Ala-Leu-Ser-Ser-Ser-Gly-Asp-Gln-Glu |
| Sequence Shortening | GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE |
| Activity | Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; Cancer cells; Biofilm; Immunomodulation |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
Related products
- Adenoregulin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ250)
- Porcine β-defensin 103 isoform X1, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ89)
- CHRG01, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ338)
- Gageotetrin B, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ409)
- Termicin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ625)
- LL-37-Cys, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ657)
- GMPRGA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ420)
- Pardaxin P5, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ553)
Online Inquiry