Aeschna defensin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ252)
Product Quick View
Aeschna defensing is an antimicrobial peptide derived from hemolymph of dragonfly aquatic larvae. Aeschna defensing has strong activity against gram-positive bacteria.
| Overview | |
|---|---|
| Synonyms | Aeschna defensin; Dragonfly defensin |
| Source | Insect |
| Sequence | Gly-Phe-Gly-Cys-Pro-Leu-Asp-Gln-Met-Gln-Cys-His-Arg-His-Cys-Gln-Thr-Ile-Thr-Gly-Ar g-Ser-Gly-Gly-Tyr-Cys-Ser-Gly-Pro-Leu-Lys-Leu-Thr-Cys-Thr-Cys-Tyr-Arg (Disulfide bri dge:C4-C26; C11-C34; C15-C36 ) |
| Sequence Shortening | GFGCPLDQMQCHRHCQTITGRSGGYCSGPLKLTCTCYR (Disulfide bridge:C4-C26; C11-C3 4; C15-C36 ) |
| Activity | Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; Cancer; Insect; Dragonfly |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
Related products
- Plipastatin B1, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ571)
- Temporin B, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ617)
- Citrullinated LL-37 (1cit), Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ341)
- Gy-CATH, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ425)
- SAIRGA TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ598)
- Tachyplesin I TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ612)
- HYNIC-UBI (29-41), Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ229)
- Lunasin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ46)
Online Inquiry