Home
Products
Antimicrobial Peptides
LL-37 amide, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ15)

LL-37 amide, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ15)

Name: LL-37 amide, Antimicrobial Peptide (AMP)
SKU: BMWJ-0826-WJ15
Rating: 5 (1 reviews)

Product Quick View

LL-37 amide is a selective agonist of formyl peptide receptor-like FPRL1, effectively inhibiting periodontal pathogens (ED99=8.5-8.7 μg/mL). LL-37 amide exerts its bactericidal effect by activating FPRL1-mediated immune cell chemotaxis and disrupting bacterial cell membrane integrity. It can also regulate inflammatory responses (inhibiting the release of factors such as TNF-α) and promote angiogenesis. Amidation modification reduces its sensitivity to serum inhibition and improves its stability. LL-37 amide possesses key activities in bactericidal action, immunomodulation, and wound healing, and is mainly used in research on infection-related diseases such as periodontal disease and deep tissue injuries (pressure ulcers), and wound healing.

Overview
Synonyms	LL-37 amide; LL-37; LL-37 peptide; Cathelicidin; hCAP18; Human cationic antimicrobial protein 18; CAMP; Cathelicidin antimicrobial peptide
Source	Human
CAS	597562-32-8
Molecular Formula	C205H341N61O52
Molecular Weight	4492.28
Sequence	Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val -Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-NH2
Sequence Shortening	LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2
Activity	Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; HIV; Cancer; Biofilm; LPS; Immunomodulation; Human; Cathelicidin
Physical State	Powder
Purity	>98%
Storage	The power can be stored at 4°C for 2 years or at -20°C for 3 years.

For Research Use Only.