LL-37 amide TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ16)
LL-37 amide TFA is a selective agonist of formyl peptide receptor-like FPRL1, effectively inhibiting periodontal pathogens (ED99=8.5-8.7 μg/mL). LL-37 amide TFA exerts its bactericidal effect by activating FPRL1-mediated immune cell chemotaxis and disrupting bacterial cell membrane integrity. It can also regulate inflammatory responses (inhibiting the release of factors such as TNF-α) and promote angiogenesis. Amidation modification reduces its sensitivity to serum inhibition and improves its stability. LL-37 amide TFA possesses key activities in bactericidal action, immunomodulation, and wound healing, and is mainly used in research on infection-related diseases such as periodontal disease and deep tissue injuries (pressure ulcers), and wound healing.
| Overview | |
|---|---|
| Synonyms | LL-37 amide TFA |
| Source | Human |
| Molecular Weight | 4492.28 (free base) |
| Sequence | Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val -Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-NH2 |
| Sequence Shortening | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2 |
| Activity | Gram-positive bacteria; Gram-negative bacteria; Fungi; Virus; HIV; Cancer; Biofilm; LPS; Immunomodulation; Human; Cathelicidin |
| Physical State | Powder |
| Purity | >98% |
| Storage | The power can be stored at 4°C for 2 years or at -20°C for 3 years. |
For Research Use Only.
- EK1, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ394)
- Aurein 2.4, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ271)
- Bactenecin 5, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ282)
- Temporin B, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ617)
- Clovibactin, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ154)
- R2R01, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ114)
- LVTX-8, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ484)
- NP213 TFA, Antimicrobial Peptide (AMP) (CAT#: BMWJ-0826-WJ123)